PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g009020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 433aa    MW: 48004.1 Da    PI: 5.4486
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g009020.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.6e-18284338256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Csa20g009020.1 284 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTK 338
                     678899***********************************************98 PP

2HD-ZIP_I/II127.84.7e-41284373191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlsk+q+++LE+sF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Csa20g009020.1 284 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELR-TL 373
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-17263338IPR009057Homeodomain-like
SuperFamilySSF466896.42E-18276341IPR009057Homeodomain-like
PROSITE profilePS5007116.989280340IPR001356Homeobox domain
SMARTSM003891.5E-16282344IPR001356Homeobox domain
PfamPF000463.3E-15284338IPR001356Homeobox domain
CDDcd000861.53E-15284341No hitNo description
PROSITE patternPS000270315338IPR017970Homeobox, conserved site
SMARTSM003407.2E-26340383IPR003106Leucine zipper, homeobox-associated
PfamPF021839.8E-11340373IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MELALSLGDN TKKQFPFLEK HSKINNPSAS STSTSDKDLG FCMGLDVAFA GHRSLSSSSS  60
PSVEFVNKKP APRTNNLGGF RVSSSVDPPL QLQLHFPNWL PENGRQEGRI LSGVATVVAE  120
EEDEVEEAVP SMSVSPPNSV TSSFQLDFGI KSYGYERRNN KRDIDDELER SASRASNEDN  180
DDENGSTXVC LICDKKEGPG RQEGRILSGV ATVVAEEEDE VEEAVPSMSV SPPNSVTSSF  240
QLDFGIKSYG YERRNNKRDI DDEVERSASR ASNEDNDDEN GSTRKKLRLS KDQSAFLEDS  300
FKEHSTLNPK QKIALAKQLN LRPRQVEVWF QNRRARTKLK QTEVDCEYLK RCCESLTEEN  360
RRLQKEVKEL RTLKTSTPFY MQLPATTLTM CPSCERVATS ATQPVTSASQ NLGLATSSLH  420
CPVKPRSAKQ VS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1282288TRKKLRL
2332340RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4311820.0AJ431182.2 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT14 (hat14 gene).
GenBankAK2274230.0AK227423.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL14-07-H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010452611.11e-158PREDICTED: homeobox-leucine zipper protein HAT14
SwissprotP466651e-143HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLD7LZT31e-137D7LZT3_ARALL; Homeobox-leucine zipper protein 14
STRINGAT5G06710.11e-140(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-128homeobox from Arabidopsis thaliana